PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g085640.1
Common NameMTR_1g085640
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB
Protein Properties Length: 389aa    MW: 44196.3 Da    PI: 6.5067
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g085640.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
  Medtr1g085640.1 14 KGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding47.34.6e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +++eE+ l+v++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Medtr1g085640.1  67 RGTFSQEEENLIVELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-28664IPR009057Homeodomain-like
PROSITE profilePS5129418.926961IPR017930Myb domain
SuperFamilySSF466892.2E-2912108IPR009057Homeodomain-like
SMARTSM007172.7E-131363IPR001005SANT/Myb domain
PfamPF002492.7E-151461IPR001005SANT/Myb domain
CDDcd001671.57E-111761No hitNo description
PROSITE profilePS5129425.362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-2565116IPR009057Homeodomain-like
SMARTSM007173.0E-1366114IPR001005SANT/Myb domain
PfamPF002491.2E-1367111IPR001005SANT/Myb domain
CDDcd001674.08E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRHIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQEEENLIVE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKRLRQKG  120
IDPVTHKPLS EVENNGEENA NKSREKAPDI LLSNELNLLK SESSKSDAAS SYEQRTTSSI  180
SPKAYAMEME GSCNKEFFID RFIQPSDLMG NFPLQMSYAN TENDCLPNDS NTSSNHWFNQ  240
TGKSFDMNSD QFHFNPTTTS TTMFLPNSFC CNNSLDIPSD NVSTEMRTSS SSTLNLHNNN  300
FSSWGGLMEN HTEEAKWENN NSNYFQNPIL MLASESLCNE IKPPLMNFVP DSFGGILPHT  360
KQEQEQSQTT SNIFSKDIQK LREAFGDM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKRLRQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.256040.0seed| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013469134.10.0myb transcription factor MYB64
TrEMBLA0A072VMV60.0A0A072VMV6_MEDTR; Myb transcription factor MYB64
STRINGGLYMA02G00960.21e-172(Glycine max)
STRINGGLYMA10G27940.11e-172(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.36e-92myb domain protein 55
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]